XQAQGNEQQSQSNYDSPSFLQRQNNFPPASKSHGVTIIPPLQNTLKVKAGNPSHNGRVCS      VWD1

TWGNFHFKNFDGDIFYFPGVCNYIFASNCKSPYEDFNIQIRRTMVENATVITHVIMRLEG

AVVELTRTSVLVNGKQIQMPYSHMGVLIERSNSYIKVSAKLGLTFLWNEEDALLVELDKK

YANQTCGLCGDFNGIPTNNEFISQNAKLTAVQFGNRQKIDGPTEQCDDPIPSAVLMNCSS

EFASICKTVLTSEAFTSCNALVDVQDYIDTCIQDLCHCDTSMADFCMCNTFAEYSRQCAH

AGGQPLNWRTSELCRMVFDDINGAGCIPRKECHCTYEGETYAPGTSFSSKCRSCTCAGGE

WTCVTQSCPATCSIEGGSHITTYDEKYYSFYGDCSYVLTKLCDSNDFTVLGDIHKCGLTD      VWD2

TETCLKGVAISLSGGQTNIVIQPSGSVFVNMIYTQLPFSAANVTIFRPSSFFIILQTTFG

LQLQIQIVPLMQLFINLDPSQKGQTCGLCGNFNDIQTDDFKTTSGVIEGTSAAFGNTWKT

RADCPDAKITFENPCTLSIENDKYAQHWCGLLSDTTGPFAECHSTVNPEVYQKNCMFDTC

NCENTEDCMCAALSSYVRACAAKGILLNGWRNKVCTKYTNTCPKSLEYTYNVDSCQPTCR

SLSEPDVTCNIKFVPVDGCTCVNGTYMDESGKCVPAASCPCYYKGMPLSTGEVIHDNGVV

CTCSYGKLSCIGEKPPPVCAPPMVYVDCGNATAGVTGAECQKSCQTLDMECYKTHCVSGC

ICPPNYVSDGKGGCIAAEECPCVHNGDSYRPGESIRVGCNNCTCRNRKWHCSEEPCLETC

SVYGDGHYTTFDGKRFDFEGDCEYVLIQNYCGRKGLNQGTFRVITENIPCGTTGTTCSKS      VWD3

IKVFLGNYELVLSDGHSDVIQRSPGGEMPFQIRSMGIYMVVDTTVGLILMWDKKTSIFIK

LSPSFQGHVCGLCGNYDGNGNNDFTTRSQSVVGNVLEFANSWKVSSTCPNANQTKDPCTA

NPYRKSWAQKQCSIITSEVFAKCHSQVEPNEYYQACVDDACACDTGGDCECFCTAVAAYA

QACNELDICISWRTPSICPLFCDYYNPQGECEWHYKPCGAPCMKTCNNPSGKCLHELRGL

EGCYPHCPKNKPYFDEETMACVSNCGCYENGKHYKPGMQMPSKQNCQTCECTNHGKICKY

DEHECVCIYEGRTYNYTDMIYNTTDGIGGCIVATCGPNGTLQRVVYDCPISTSPTTPFHF

STTPPATASTVTSSPTTSVCVHEVCQWSEWYDGSPLIPGFDGGDFETFSDLRAKGYEVCR      CysD

DPKAVQCRAEKFPNIPLKDLGQRVECNTQSGLICYNKDQISTMCYNYEIRILCCVFVPCS

STSSITTPYETSTLITHTPVPEKTTTATSTIITTSSTTTETGSTTITSTSSETASTSPEA      PTS

IRTTPCQPKCKWSKWYDVHFPTLHNKGDYETYQDIRSAGKAICRNPEKIQCRAEKYPHKS      CysD

IEEIGQVVHCNVTYGLICRNEDQKGELHICLNYQVKVFCCDDYSHCQTRVTPTVPEEITT      PTS

TITQSPATTTSETSTFTTKLTSPVTISPTTSALCVKEECDWSVWYDVSYPEPGYNDGDFD      CysD

TVQNIRKQGYEVCANRMAVECRAXXXXXXXXX

XELIYSTMDSDGCRFYARCSETCTIERYTGDCNFTTPVTTTSPQTPTIITSRPTLPPGCV      PTS

SSTHPPLQPGQKFKLSNCTELICEGNNKVVVNQTVCPPVKEITCANKYPAILVPDENGCC      CysD

YHYECQCVCSGWGDPHYITFDGTYYTFLENCTYVLVKQIVPKFDNFRVHIENYYCDSKDG      VWD4

LSCPKSIIIFYKSATVKLTRELLNGMMTNVMYFNNKIVQPGFHKDGIYFSTLGINMIVEI

PEIGATITFSGLIFSVKLPYSKFGNNTEGQCGTCTNNKRDECRLPSGKIISSCPQMAHHW

LVGNDTSCSGVPTPPIVTTPPARPQCHVPELCKLIISKVFAECHDVIPPEPFYKGCVFDG

CRITDESMQCSSLEIYATECAARGVCIDWRGKTNNTCRHGCVVNETYYAPGTVIPSGPCE      VWC

SCTCSRSSYSGRQKFAVKCQPVTCDTYCPVGYKYTEEPGKCCGTCKAEACIVVMEDGTTH

VLKVGKFWSPPGNNCTTYTCEKYNGQFMTVISKKSCPAFNPDLCEPDNIQLSDDGCCRVC

SIPPSGCKKHNTSTVIKYQGCVSAPVEMTYCEGSCDAYSKYSQEANMMEHKCSCCQEIQT      CK

SIRKVTLTCSDGTYLDHSYTYVDQCSCVGAECVPQDIANQQQQTGKI                   1

 

1. Est support stops here. Then there comes some sequence else in another exon and then stop codon and 3 UTR (one exon more, sequence below), but thus the intron will not follow GT-AG rule.

 

PQLLDNI-